PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008910
Common NameRCOM_1612510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 436aa    MW: 47216.5 Da    PI: 9.9014
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008910genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.35.8e-23108149445
            WRC   4 pgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                    +grCrRtDGKkWRC+++v+ g+k+CErH+hrgr+rsrk++e+
  30174.m008910 108 SGRCRRTDGKKWRCKKIVVTGQKYCERHMHRGRHRSRKPVEA 149
                    68*************************************997 PP

2WRC58.61.1e-18313351341
            WRC   3 epgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrk 41 
                    e grCrRtDGKkWRC+r+v++++k+C  H+hrg +++r 
  30174.m008910 313 ETGRCRRTDGKKWRCRRDVVPNEKYCKMHMHRGAKKRRE 351
                    889******************************888775 PP

3QLQ43.41e-155286337
            QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                   +TaaQl++Lk Q+ +y y+aa++PvP+ L+++i+k
  30174.m008910 52 LTAAQLNELKLQVSIYEYIAAGLPVPSALVFPIWK 86
                   8********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.9E-75086IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.0095186IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-115285IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.276105149IPR014977WRC domain
PfamPF088793.3E-19109148IPR014977WRC domain
PROSITE profilePS5166719.993311355IPR014977WRC domain
PfamPF088793.6E-16313350IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MIKYGTLKVV VQVKKAKEEE EELASSMNLI IGIGAAEHHD SLVIVKHEKP LLTAAQLNEL  60
KLQVSIYEYI AAGLPVPSAL VFPIWKSFAA SFHSCGSIAN AGIRPSYSGR CRRTDGKKWR  120
CKKIVVTGQK YCERHMHRGR HRSRKPVEAS QVVAASEATS LNNSTKISEN SSTISTPASL  180
SNHVNSATRT TNVDTKIMTA NTTLTAKDVG CVNAKETMIT STVLTDSTIG TATMGTNKSS  240
SNGSRKINGI DDKKGNCGNN ANLKNLTDRG NNGKNIINAS SATPQGMNFS PKSVLQVEGC  300
SSACFCRSDA ELETGRCRRT DGKKWRCRRD VVPNEKYCKM HMHRGAKKRR EGLQSLAHLN  360
ATTNILTSIR LQSTTVLPNK EDSTYLNTNL SISISAPANP QLAINNDLSN KTISSSSSTT  420
ISDTIAACCE DIDFSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015584460.10.0PREDICTED: growth-regulating factor 9 isoform X1
TrEMBLB9RDF20.0B9RDF2_RICCO; Putative uncharacterized protein
STRINGPOPTR_0014s06750.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.18e-46growth-regulating factor 9